SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_13051 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_13051
Domain Number 1 Region: 10-171
Classification Level Classification E-value
Superfamily CinA-like 3.4e-37
Family CinA-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_13051
Sequence length 176
Comment | BC1G_13051 | Botrytis cinerea predicted protein (177 aa)
Sequence
MSEAKEFPPQKVKEVVIEVAKLLKERGETVSVAETAAGGIISASILSTPGASKVFKGGLT
VYTLESRVAFAGWTPENTASYSGPTPEVVAGMAENVRAKLGSTYCICESGTAGPGASGEG
RNRQPGYVALAIATENGTYKKDLSTGLGGDREGNMVAFAKEALAFLRDVLKGDAKL
Download sequence
Identical sequences G2YPU9 M7TAC7
332648.A6SJF3 XP_001548656.1.26476 BC1T_13051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]