SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_13074 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_13074
Domain Number 1 Region: 362-492
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-35
Family Bromodomain 0.0000379
Further Details:      
 
Domain Number 2 Region: 158-319
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.33e-21
Family N-acetyl transferase, NAT 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_13074
Sequence length 497
Comment | BC1G_13074 | Botrytis cinerea histone acetyltransferase GCN5 (498 aa)
Sequence
MAPQDIDSDLGKYWNTTGPRRPRTQLSRSSIEKAPNPTERTVSGESSLDSLTPSEESISD
FEDTDQEDTESNTVMGPNLQDTPKRKAGTEESLSNSQNAPKRKATEEPPSFPVSSKKMKM
SETELTENLKKANAEHPANINIIPFPEKVMIEEREGEIDFRVVNNDDTNESTIILSGLKG
IFQKQLPKMPKEYIARLVYDRNHLSMALVKKATLEVLGGITYRPFDDHEFAEIVFCAISS
DQQVKGYGAHLMNHLKDYVKASSKVMHFLTYADNYAIGYFKKQGFTKEITLPKPLWMGYI
KDYEGGTIMHCEMVPRVRYLESNRMIVKQKEVVNAKILAFSKSDEVHAPPKQWKNGAFPI
DPMSIPAIRASGWTPAMDELARQPRHGPNYAQLSRLLSSLQNHQKAWPFKAPVNGNEVAD
YYSVITNPMDFETMERKLDQDSYEKPEDFVADATLVFSNCKKYNNDSTPYAKCANKVEKY
MWSLIKEIPEWSYLLDN
Download sequence
Identical sequences 332648.A6SKG2 BC1T_13074 XP_001548238.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]