SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_13708 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_13708
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.02e-19
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_13708
Sequence length 122
Comment | BC1G_13708 | Botrytis cinerea predicted protein (123 aa)
Sequence
MLQDHHLWVAVDDEDKPVGFLGGFKVDDNFHVAEVSVKKDNQRQGIGNSLMYRMMKDIKE
EGFPAITLTTNQILPFNRPWYQSLGYIELEAKDIGNELTLLIEEESNHLDNNLRCAMRKN
IL
Download sequence
Identical sequences 332648.A6SNC8 BC1T_13708 XP_001547220.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]