SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_13863 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_13863
Domain Number 1 Region: 219-492
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.39e-106
Family N-acetyl transferase, NAT 0.0000000102
Further Details:      
 
Domain Number 2 Region: 20-118
Classification Level Classification E-value
Superfamily Chromo domain-like 3.94e-21
Family Chromo barrel domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_13863
Sequence length 504
Comment | BC1G_13863 | Botrytis cinerea histone acetyltransferase ESA1 (505 aa)
Sequence
MTGPSQDKDSSVGTPVPKQKSKATIDTLGVGCIAMVQKDGALRRAEILSIKETKSGRQFY
CNFDNFNKRLDEWVPAIRIDFTQDVEWPAPEKPKEKSKAPPAGKKTIVGNKKNQKRPTQA
SKREDSVVSESGSNAPPWSEFAESQRQTPDADGDAKLTMALDLDATPEANDPMDVDEAAT
EAANAKNEPAQQFSPKEEIEKLRTSGSMTQNQAEISRIRNISKVQFGKFELYPWYFSPYP
EAFTQEDLMYICEFCLSYYGDLKAFTRHRGKCTLQHPPGNEIYRDDYVSFFEIDGRRQRT
WCRNLCLISKMFLDHKTLYYDVDPFLFYVMCSRDEKGFHLVGYFSKEKESADGYNVACIL
TLPQYQRKGYGRLLINFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWTERIVEELLIHNE
KDERISIEGLSQKLNMTSADVEHTLQALKMQVYHKGEHKMVLPTALIKRHEAMREKQKLK
PKRVIDPSRIVWKPFKLVDRTWGW
Download sequence
Identical sequences G2XRY3 M7UP48
XP_001547701.1.26476 332648.A6SLY5 BC1T_13863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]