SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_14003 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_14003
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000183
Family N-acetyl transferase, NAT 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_14003
Sequence length 533
Comment | BC1G_14003 | Botrytis cinerea protein SPT10 (534 aa)
Sequence
MPPEKFASYWFQNFGAVMLLGSIESADEVVEGKNWATECLGSYYIKPNYPGRSSHVCNAG
FLVTDAARGKGVGRLLGESYLHWAPLLGYTYSVFNLVYETNVASCRIWDALGFKRIGRVK
GAGNLKSYPGQFIDAIIYGRDLGPDGSDFVSEERFDKIKFYLKHKEYPLGADRAEKSRLR
SAATHYKLLPDEDKLMLKGKEVISDPQKQYEIARGIHVLQHGGINKTTAIIAEKYHWVRI
KETVSLVIKNCGECKELGKAPVVKPDYQAQLARQSPPKSQDVTDANILSLPEQQQLDHHR
DIHQHHDRQSQPSHLQHDFQQIQHHHDHTSTSVSPQVLNRRLPSHSPHLHSNPIVHLKQH
QPPISQMQLHHAETRTQSQAQAQAQAQAHSHSPSHRHSATDYLQIDPQIMDYTHTSHSPH
PHFDAHHEHDTDSFQAMLENRDVDVDVDADGGGGTGVDGDIDDMLVDQDEVEVEHIGDIG
TVEHNNTGDDINTDETMSDSMGNPRHKSHDDVMATARLAQGMISRGVMDRNEG
Download sequence
Identical sequences 332648.A6SMS1 XP_001547376.1.26476 BC1T_14003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]