SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_00771 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  BC1T_00771
Domain Number - Region: 427-475
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00026
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number - Region: 244-273,327-353
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0407
Family N-acetyl transferase, NAT 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BC1T_00771
Sequence length 479
Comment | BC1G_00771 | Botrytis cinerea predicted protein (480 aa)
Sequence
MADSSIEVLRKRKSDSGVDTSTDLPATITGLSVTTTVAKRSKMVIGVNTLISDELIATNE
SEVDVDRIYHQPTVSDVEDPNVGASEELSKDEFDDELGDEYSYEDENIHGAGDSGSREYG
VEGREITIQQDGTDNVAKLRLFLTKDDEFADWLHMIHVNCTVDGKRIGHAFGQYICREEI
REDFWSEMEAPSRELSLVAFKLFDRYGYLNGHLKNHCVQKGTGVWGDELDFGSLFILEHV
EVTERKWRRKGLGRAMVGDLVKKAEVLHKPSPLNTPEDNMFEDMFWFGRNKERERRAKIH
IISMPGYLRHDVEPQYEGKSEPEQHEINSRAIDSAISFHRSLGFRRIGASSYFGLSPDPN
HKSHSLAIQDDFDPPKPPSTPAEEPELVGLEKLRKKLTPLNFAAVSLPDVELLEFYKTFQ
IEDEKEWKQVDHLDNTLLHIAACQFKLQSVQWLMDNVNDKQSLTSARNIDGYTPLEALQ
Download sequence
Identical sequences 332648.A6RK00 XP_001560743.1.26476 BC1T_00771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]