SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BC1T_05960 from Botrytis cinerea B05.10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BC1T_05960
Domain Number 1 Region: 24-154,317-436
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 6.28e-83
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00039
Further Details:      
 
Domain Number 2 Region: 201-302
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.51e-27
Family Group II chaperonin (CCT, TRIC), apical domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BC1T_05960
Sequence length 444
Comment | BC1G_05960 | Botrytis cinerea T-complex protein 1 subunit epsilon (445 aa)
Sequence
MAMTSVIKDEQGRPFIVVRDQGKKKRQHGNEAVKSHILAARTVANIVKTSLGPRGLDKIL
ISPDGDITVTNDGATILGQMEIQNHVAKLLVELSKSQDDEIGDGTTGVVVLAGALLEQAA
ELIDKGIHPIRIADGYDQACDIAVAELDRIADTIEFTKTQKENLVKVARTSLGSKIVSKA
HDQFANIAVDAILSVADLERVIVDKDFSHPQMPDEVRDAKIAILTCAFEPPKPKTKHKLD
ITSVEEFKKLQTYEKDKFTEMVQQIKDTGANLVICQWGFDDEANHLLLQSQLPAIIDEAK
RSLHDALCVVRNLVRDNRVVYGGGAAEIACSLAVEDAAVKSPGLEQYAMRAFADALDAIP
MALAENSGLSSIETLASVKSRQATEKNTRLGVDCMQTGSNDMRDAFVIDPLIGKKQQLML
ATQLCRMVLKINNVIIAGNDENEF
Download sequence
Identical sequences XP_001555255.1.26476 BC1T_05960 332648.A6S086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]