SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_06882 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_06882
Domain Number 1 Region: 3-272,413-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.33e-46
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00096
Further Details:      
 
Domain Number 2 Region: 258-410
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.69e-27
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00095
Further Details:      
 
Domain Number 3 Region: 539-600
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.000000000000236
Family Cytochrome b5 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BDET_06882
Sequence length 601
Comment | BDEG_06863 | Batrachochytrium dendrobatidis hypothetical protein similar to fumarate reductase (602 aa)
Sequence
MSRIIVVGGGLAGLSAAHTVLERGGSVLLLDKNAFLGGNSTKATSGINGAGTATQIKLGI
PDNSQIFYEDSAKSARAEIVPALTKVLTYQSGSAVEWIQDKFKVDLSLVSRLGGHSHPRT
HRGTEQFPGMTITYALMETFEDTAKATPALAQVIKKANVVKLLTEGSKVVGVEYVKDGKP
FKEMGPVILATGGYAADFTNTSLLKKYRQVSNLLVTLSPILSDPELWDLPTTNGDHCTGD
GIKMTLAVGGNTIHMDKVQVHPTGLVDPKEPDAKVKFLAAEALRGVGGLLLDANGNRFAD
ELGHRDYVTGQMWKNKGPFRLVLNGKAGKEIEWHCKHYMGRGLMKHYKGAAAVSQDTGMP
LKNLESTFSTYNNIAKTKNDPFGKKFFHNTPFVMDDEYWVAVVCPVLHFTMGGVQIDDQS
KVLSPSGPISGLFACGEMAGGVHGANRLGGSSLLGCVVYGRVAGATAAAYLMNQFSAERR
LGAVAGHLAAAPVTVTVGGVTVSVTQGGASACPASGATTSSHDSHPTESASPASASAPTK
LKEYDLAEVAKHNKDTDCWVVVNGQVLDATNFLADHPVNMMHKPEVVEKYAPETVIGTLK
K
Download sequence
Identical sequences A0A177WUY9
BDET_06882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]