SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_06964 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_06964
Domain Number 1 Region: 44-305,404-477
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.62e-81
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 496-639
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.92e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 282-400
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.54e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BDET_06964
Sequence length 639
Comment | BDEG_06945 | Batrachochytrium dendrobatidis succinate dehydrogenase flavoprotein subunit, mitochondrial precursor (640 aa)
Sequence
MFSGAALRKSARIVQHRSFHASAFTQRISTTQTLRASAAQSTISAAYPIIDHTYDALVVG
AGGAGLRAAFGLAKEGLKTACITKLFPTRSHTVAAQGGINAALANMTEDDWRWHMYDTVK
GSDWLGDQDAIHYMCREAPQSVIELEHFGVPFSRTPEGKIYQRAFGGQSLKFGKGGQAYR
CAAVADRTGHAILHTLYGQSLRHDTTFFIEYFALDLIMENGECRGVIALNMEDGTIHRFR
SHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVTRAGLPLQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGYLLNSEGEPFMARYAPTAKDLASRDVVSRSMTIEIREGRGVGPQKDHLYLQL
SHLPAEVLHSRLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVINYVDGK
DVVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRAAALHIKDTLAPDTPHKPLPADA
GAATIANLDKLRYASGANPTANVRLEMQKVMQTDAAVFRTESSLLEGVKKIDQVSTKLKD
LKVTDRSLIWNTDLVETLELQNLMTNAVQTMHSAYARKESRGAHAREDFKDRNDTEWMKH
TLSRHDLETGAVSLEYRKVISHTLDENEAKSVPPVARVY
Download sequence
Identical sequences A0A177WVX9 F4P8I9
BDET_06964 jgi|Batde5|90431|GP3.059900 XP_006680864.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]