SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_00810 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_00810
Domain Number 1 Region: 197-287
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 5.89e-29
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00038
Further Details:      
 
Domain Number 2 Region: 276-416
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-25
Family UBX domain 0.00037
Further Details:      
 
Domain Number 3 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.000000000221
Family TAP-C domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BDET_00810
Sequence length 419
Comment | BDEG_00806 | Batrachochytrium dendrobatidis conserved hypothetical protein (420 aa)
Sequence
MADDSSSRDETLAQFAAVTGLNGSQAQFFLESSDWDLQTAISTFFESQSAAEQSAAGSAP
IQEHSTAPFPSQANNLPKSSTGKNASGFSSSNSRVKTFQEMLASTSDKEDDQEERENYFA
GGEKSGVMMQGGPKEKKGDALNLVKNILTKAAKSGPSSEELEKETKPLFFGGSGRRLGSE
EDVDTGPLQPVEQVTDPSTQRVERHLTFWRNGFSIDDGPLREYDDPVNQEFLKAINSGRA
PTSMLNVAYGQPVEVKVAHCMQQDYQPPPKQPMAAFSGSGNRLGGIVAGGPSSSQNASVQ
VSIPGAYPTSPSFSCTTTVPNAIPMLTPTSTIGPLVTIDADMPTTSIQIRLGDGTRMVAK
FNHTHTVQDICSFVRASRPGGAAQAFVLQTTIPVRQLTDLSQTIKDAGLLNAVVVQKYV
Download sequence
Identical sequences A0A177WA81
BDET_00810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]