SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_02446 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_02446
Domain Number 1 Region: 369-461
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.69e-23
Family UBX domain 0.0087
Further Details:      
 
Domain Number 2 Region: 159-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-19
Family Thioltransferase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BDET_02446
Sequence length 466
Comment | BDEG_02439 | Batrachochytrium dendrobatidis hypothetical protein (467 aa)
Sequence
MQAAVEQFYSAGHSSRVLNHGMDQVDNFEDKNQQFIDLQNNAPLLPTASSVAVALDEPQR
LRNNVQRPVEFITLSCLHNECDIQADSTPTLTALFTTPFQWGFKFFWAILSYTRKIVDVG
LFQFLGLGVSGRRRTVGGSGMQRNRSSTERSTAECASVRFKEDFESQYGSKHPPFFVGTY
TQALNTAKSEIRYALVILQSDEHDDTDKFSRETISSDTFISFVSEKNLLVWGGNIHDAEA
FKVSAVLNATSYPFMALITLQGSRMAVAHRFEGLMSTGRIISKLRRLIDRFDPLLAGARA
DRASHAAARSIRQQQDDAYQASLLADQEKARKAKEEEEQAKKALLEQEQQRIAGLTKLER
RKQLKIELAANMPVEPDVGEPNTTRLSIRLPSGERVIRRFKADDTIQILWNFIETHDLKP
LDLETEFSIVCPFPRRVYRNMDMTMEQAGLVPSASVVVEEMFDDGL
Download sequence
Identical sequences A0A177WEH2
BDET_02446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]