SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_06625 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_06625
Domain Number 1 Region: 75-165
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000668
Family Ubiquitin-related 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDET_06625
Sequence length 531
Comment | BDEG_06607 | Batrachochytrium dendrobatidis predicted protein (532 aa)
Sequence
MWDDSVAGEMGSVGSMILNLPNSSSLQLFYAISTEASHRLDNKQVEPRSKVVKLQLERPP
KENQHIARMDSNETDTPLTILARLSSGQKVPVTILDPANTTVLDLKELVAAAISTSPGSI
RLVLRGRILKGDELPISNYAVADKDVVHVARTDPSTANSVAPQPRATTASLAGSGLSETQ
TAFHYRTTQPQSSTTSNTTPSPGITGSALAAGLSSQSAANGFGGDEMASLMSNPMIQTIF
ENPEFLQLMLQSDPRMRAMMEENPEIRAALSDPSVLREISRGMQNPRLMQEMMRNQDRAL
SNIEAIPGGFNHLSSMYRQMNGPLNAGRTPDPSTDEANRQMANLLGATSPSNASGPNSQA
LPNPWDIRPGNVGTQRPVSLPTSTTLTNMLGTFGAPSSVNRNAASTNTEARHFPFMPFPS
LPGNLGNSSTRTPGSDTIQPHLQMLQQMAQMNQSPRASFPNQFDVMPPALSNSNSPMNPF
LELFGAPSLSPSQLAQPSGDPAAAQPAIEEQYREQLASLRDMGFVTASCIL
Download sequence
Identical sequences A0A177WSY9
BDET_06625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]