SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_07783 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_07783
Domain Number 1 Region: 241-327
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-19
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDET_07783
Sequence length 876
Comment | BDEG_07762 | Batrachochytrium dendrobatidis conserved hypothetical protein (877 aa)
Sequence
METNNTTSDKNGIDATHSNNLPTDLDSVDTTSAKLSTSLHHQSHISKYNAEMTNVDTLNH
DMHESLVALDESNDISFSATTPTTVVNTETIDSLKESMASHTSHSNPESLQHSSIISTTT
IESVSNMAHYALSAALPKSPIQSDPVEPPTPLHSNPVNPSTLIQSKELKKSIKDPNVLIP
SLSTSTFVPTPPIAPRPKATSPQRKASSELNPLSIKISNRQQLQLQKLKQIQHLQKLKCQ
HKPPMEFTIHVGTLTGQVISLNVFSHFTIGDIKYQLFEQIGIPVEHQQLVFCEHHFVKDE
ATLDECGIQNGSTLHLVLHMTGGPGLPTISKTVSSSEKDVVFLLCKQNEDIFMLEVDMKD
GNNPKTVAKHVLRLAEGMAGAKIFQCLDSAEFFDISDLGDLDFDHDKQDNVGLSDGNEID
EDYSSYDSQKVDSFLSELKANRPYSSGSTSSTCTFTSFISSDSVDWEILSKQELHRMTID
SLNSSKSHKEDQQLTLPKPSSIATSRCMSSISSARSLSYESVSDNDIYESNHTTVSSMST
LEHLLYHANVIFSSQSQDHPPRLIVRTPRAASSKKQGKSAKKLSTASARPATAISIMRLP
AGALPMFIIPKTRPASAEQQIQLLHQQIQFQFQKSLQSSDHSNDANQKPSHLFSIGNLIH
NRDIDQSADFDAQNSIQLETNVTQTIETALETEKESLYTILQKRENSSSNSTLSSINDML
LSSSYSSACSSLLEKQAQNSHTGFHSHQYRSKYQPIPSKNSKGATIKKKSNASFGFQESR
VLQSNKSPLGLNAALHHKTKTCLSRENSYCSDADWTSKNNRRHQALPYPSQSYNRLSSGV
KLPPMDNPTLFDSSSDMSEFQTKLSQTMPDSFSHPR
Download sequence
Identical sequences BDET_07783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]