SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDET_08377 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_08377
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-18
Family Ubiquitin-related 0.0028
Further Details:      
 
Domain Number 2 Region: 290-345
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000383
Family UBA domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BDET_08377
Sequence length 350
Comment | BDEG_08352 | Batrachochytrium dendrobatidis hypothetical protein (351 aa)
Sequence
MSVSKDISIKIKCSNEAAFTLTIDPQTDTVLDLKNKITAHLLQSEGSTNVSAETMRLIYS
GKVLKDPDMLSVYKVSDSATLHMVRGSRPPGTVSPSAAGTPSTPTPTQPSTNAFATTPTD
QPGSRTAPLGNPFAANAGANPFAAFGGGSMPGMPGMPGMDSMMQDPAMMGMLSQMMANPQ
IMESLISMNPQLAGMMTPEMRQIMQSDQFRSMVSNPQVMQQMMQMSANMGGMQGMGGNPF
GMHGQSQPASTTAMGDRSTPSSTQPNPTTFPPLPMFNPGMMQMLMGGQSGANVTPGQPTR
PPEEVYQVQLRQLQDMGFYSPSENVRALTLTGGNVEAAIEWLFSHPPGTQ
Download sequence
Identical sequences A0A177WZU8
BDET_08377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]