SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|29049|fgenesh1_pg.C_scaffold_207000002 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|29049|fgenesh1_pg.C_scaffold_207000002
Domain Number 1 Region: 116-244
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.7e-35
Family HPr kinase/phoshatase HprK N-terminal domain 0.00099
Further Details:      
 
Domain Number 2 Region: 247-414
Classification Level Classification E-value
Superfamily PEP carboxykinase-like 1.19e-31
Family HPr kinase HprK C-terminal domain 0.000043
Further Details:      
 
Domain Number 3 Region: 39-109
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 3.11e-26
Family PhnA-like 0.0000472
Further Details:      
 
Domain Number 4 Region: 3-35
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000000502
Family PhnA zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|29049|fgenesh1_pg.C_scaffold_207000002
Sequence length 420
Sequence
MSNLPNCPNCNSEYTYEDGILLVCPECAHEWTADSEVAEEEKAVKDANGNVLNDGDTVTL
IKDLKVKGSSTPLKVGTKVKNIRLVDGDHDIDCKIDGFGAMQLKSEIGKEVLPEVKSIGV
KDLVREFSLEVLAGEDQIGRKITTSKTHRPGLEFIGYFDFFPMERVQILGLKEITYLHQL
SQSERQLRIRNVVHYHPPCFIVTTGQKGLMYLKQFCTEEGIPLLRTKEDTTDFIAKVDAY
LTRSLAPEIAVHGVCLNVFGIGILLRGESGIGKSETAHTLIGRGHRLVADDMVVLKKLSH
KTILGTHNQMNKEFLALRSVGLLNVVRVYGRKAFQDETRIALDIELTEWKKHTLNNELEL
ETSYTEYMGVSIPHIEIQLQPGRDVAGLIEAAANNWYLKQQGYSAAEEFIGRIESDDSNK
Download sequence
Identical sequences F4PG26
XP_006683560.1.45406 jgi|Batde5|29049|fgenesh1_pg.C_scaffold_207000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]