SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|93031|GP3.085900 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|93031|GP3.085900
Domain Number 1 Region: 451-636
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.73e-71
Family Polyphosphate kinase C-terminal domain 0.0000366
Further Details:      
 
Domain Number 2 Region: 60-262
Classification Level Classification E-value
Superfamily PHP14-like 2.35e-56
Family PPK middle domain-like 0.00028
Further Details:      
 
Domain Number 3 Region: 267-446
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.22e-54
Family Polyphosphate kinase C-terminal domain 0.0000134
Further Details:      
 
Domain Number 4 Region: 1-59
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 0.0000000824
Family PPK N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|93031|GP3.085900
Sequence length 639
Sequence
MVRVAGLKDQVQAGFNKPENKAGLTPKQQLNAIAKLNHTLVDKQYEGFNALQQALADEEI
SILEMDDLTIEERDTLEEYFDEQIFPILTPMAIDAYHPFPMLLNKSINLAVVLEDTYEVE
FKSRKNAIVQVPALLDRYIQIGDTNRYILLEDIISHFLYKFFKGYRVHSVTEFRITRNAD
MTIHEEGARDLLKEIEKELRKRKWGAAVRLEVRKGKYDDTIIRFLLNVLEIHKDDLYIVD
GPLDLTFLFRFYKDAQVDHENLIYQTLIPQRPQDIDSKESIFEAAEKRDIFLHHPYESFG
PVVDLITEAAIDPEVMAIKQTLYRVSGHSPIIKGLKQAAENGKQVTVLVELKARFDEEQN
VHWAKELEKAGCHVIYGMNFLKTHSKITLIVRKRKEKIERFVHLGTGNYNDSTADLYTDM
GLVTTKRKFGIDATNFFNYLSGFTEKPDFNHLSMAPFDIRADFIRYVNEEINFHQLRGNG
HIIAKMNSLTDKEIIRKFYEASQAGVKIDLIVRGICCLKPGIEGVSENIRVRSIVGRFLE
HSRIYYFHSDGDEKIFLSSADLMTRNMAKRVELMFPIYEAPVKKRVIEVLLITLQDNIKA
REQASDGTYHYVEAEPGEALIDSQMTLYDMAYDVLEDEE
Download sequence
Identical sequences F4PF87
XP_006683270.1.45406 jgi|Batde5|93031|GP3.085900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]