SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|93146|GP3.087050 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|93146|GP3.087050
Domain Number 1 Region: 310-376
Classification Level Classification E-value
Superfamily Homeodomain-like 1.1e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 393-505
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000934
Family Tetracyclin repressor-like, C-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|93146|GP3.087050
Sequence length 507
Sequence
MRDKRTLALLIFAPILVLTMLYLVFDGDDYIPKVGLVDVPEMIMGQIDLEDAEITEYRNE
TEANDDLVNQEIDGYVVLDGQTPSIFLEGSDPSVNGATLKWIQSAFVNLQQNGNSTELEV
DYLHGSSEMGSFDYFGPVLLGFFVFFFVFLIAGVSFIRERTTGTLERLLSTPLRKWEIVM
GYVFGFGIFTMIQSTIIAWYAIYVLDMMMEGTFIYVLIITLAIALTALTLGILISSFANN
ELQMIQFIPIVVIPQIFFSGLFNLETISDWLSWIVPFTPLYYAADALRDVMIRGMNKDKR
RYTMSNDELKLTEKQKAILDAATELFAEQGFAGTSTSEIAKKADVAEGTIFKHFKSKKGL
LLSVISPMIKVVAPMVKNDMNKILDRDFDKFEDFIREFIDNRIKFVVKNMTLFRVLIQEI
PFHPELKEQFIEHIGKDMLGRVRQIIEYYQEKGQIRKMPIDSVMRVIVSTVFGHVIAKLL
IIGEAEWDEEAELDRTIQFLMNGLAPE
Download sequence
Identical sequences F4PFJ9
jgi|Batde5|93146|GP3.087050 XP_006683381.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]