SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|20074|estExt_Genewise1Plus.C_80347 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|20074|estExt_Genewise1Plus.C_80347
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-32
Family Skp1 dimerisation domain-like 0.00002
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily POZ domain 3.14e-20
Family BTB/POZ domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|20074|estExt_Genewise1Plus.C_80347
Sequence length 160
Sequence
MVRLSSSDGQEFTVVKEIACQSVLIKNMLEDLGDDEDAAIPLPNVAGTVLAKVIDYATHH
KDDAPLSPEDENKNITKSSEDIDEWDKEFINVDQGTLFEIILAANYLDMKGLLDLGCKTV
ANMIKGKTVEEIRKTFNIVNDFTPEEEEQIRKENEWCEDR
Download sequence
Identical sequences A0A177WQZ8 F4P6F0
BDET_06026 XP_006679842.1.45406 jgi|Batde5|20074|estExt_Genewise1Plus.C_80347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]