SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|29931|fgenesh1_pm.C_scaffold_5000036 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|29931|fgenesh1_pm.C_scaffold_5000036
Domain Number 1 Region: 77-152
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-29
Family Skp1 dimerisation domain-like 0.0000586
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000942
Family BTB/POZ domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|29931|fgenesh1_pm.C_scaffold_5000036
Sequence length 155
Sequence
MITLLSHDKESYTVEHAIAERSVLLKNMLEDLGDTSDTTIPLPNVVEYCTYHKNDPPPPL
SESKEDVEVIRRRADNISEWDMQFIKVENDDLLELILAANYMDIKPLLDLGCMTVANMIK
GKTAEEIRTAFNIENDFTPEEEEQIMRENEWAADA
Download sequence
Identical sequences F4P1L7
XP_006678547.1.45406 jgi|Batde5|29931|fgenesh1_pm.C_scaffold_5000036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]