SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|86660|GP3.022190 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|86660|GP3.022190
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily POZ domain 2.92e-19
Family BTB/POZ domain 0.00052
Further Details:      
 
Domain Number 2 Region: 85-148
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-17
Family Skp1 dimerisation domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|86660|GP3.022190
Sequence length 149
Sequence
MVRLFSSDNQEFSVSKEIACQSILVKNILEDLDNDQNAVIPLPNITGVVLAKVIQYVEHH
KDDLFKDEPVKNLSEDKTKPFEKPTIDLDPWDKEFTTVDQSLLFDLIFAANYLNIKSLLN
LGFKAVANVVKENTVRDICQAFPISSNEE
Download sequence
Identical sequences F4NWJ6
XP_006676943.1.45406 jgi|Batde5|86660|GP3.022190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]