SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|89535|GP3.050940 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|89535|GP3.050940
Domain Number 1 Region: 4-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.14e-75
Family Capz alpha-1 subunit 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|89535|GP3.050940
Sequence length 280
Sequence
MTATDAEKLEIVSGFIKDSPPGEINDVFNDVRSLVADDSLLQNTIESTFADHHAKQLVSV
QVPSKDYEVILGEYGCIEPSKYVDPRSGQALIVDLVHQTVKSVEPYHSKCSAHLLDQRAA
LDVAVQEYTASFYPSSVCTVWATEDEALVIAIVANKYHPDSFWSGRWRSLWRLEPKSSML
TGSAKVQVHYYEDGNVQHNSTQDYSVSITASDQEPSTLAATVIKHISKLEAEYQTTLNDQ
HNRLALETFKSLRRALPISRTKIEWQGILSYKIGSELVSK
Download sequence
Identical sequences F4P5P4
jgi|Batde5|89535|GP3.050940 XP_006680060.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]