SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297538049|ref|YP_003673818.1| from Methylotenera versatilis 301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297538049|ref|YP_003673818.1|
Domain Number 1 Region: 25-208
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.42e-54
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 291-485
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.26e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00027
Further Details:      
 
Domain Number 3 Region: 224-294
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000183
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.015
Further Details:      
 
Domain Number 4 Region: 729-849
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000552
Family BphP N-terminal domain-like 0.07
Further Details:      
 
Domain Number 5 Region: 847-940
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000134
Family Heme-binding PAS domain 0.047
Further Details:      
 
Weak hits

Sequence:  gi|297538049|ref|YP_003673818.1|
Domain Number - Region: 654-745
Classification Level Classification E-value
Superfamily Tropomyosin 0.0379
Family Tropomyosin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297538049|ref|YP_003673818.1|
Sequence length 975
Comment MCP methyltransferase/methylesterase [Methylotenera versatilis 301]
Sequence
MVNTKNQLVSPSSEKPTEVDQKSKRVFPIVGIGASAGGLEAFEDFFRHCDPDIGLAFVLV
PHLDPSHVSMLTEILQRSTKMPVIEAQDQTKVEANRVYIIPPNREMAIIHGKLQLSVPTV
SHGQRMPIDGFLRSLAEDQNENAIGIILSGTGSDGTLGLRAVYGAGGNCFVQEPATAKYD
GMPTSAIKAGYVTKVLPVANMPEALQAGANSFNILSEINTETKKTHGVSHILMQLRTITG
HDFSLYKQSTVIRRIERRMLKHDITDIEIYARYLKEFPAEAHILFKELLINVTSFFRDTE
AFLVLENDVLPQLCLNKSDEDNFRVWVPGCASGEEAYSIAILLSELMDKTQQNFKVQIYA
SDLDDDAIATARAGLYPINISQDLTPERLRRFFTKEITGYKVKKEIRDMVVFAIQNVIKD
PPFTKLDLLSCRNLMIYLGAELQNRLMPTFHYALKPNGVLMVSPSEGIGSFTSLFSPISR
KWKIYRAIHNLSSPTSRFNIPTKVPTTNDSKTPEKAIKQPMENSLAEISRRLLMQYFAPA
SVFTDLKGNILYVHGDTGKYLRPAQGQASLNVIEMAREGMEIQLRAAIHSASIENKPTLN
HEMQVKTNGGFTTVSLSVRQVNYGSADKQAFLLVSFQDVVTPSNQTKRKVSSKPEELKRL
EELENDLLYLKENHQVLIEEQQATNEELKSANEELQSTNEEMQSSNEELETSKEELQSIN
EELITVNSELQTKMDQLSEMQSDMKNLLESTDIGIVFLDEHLMIRSFTREAVRIYRLVPS
DIGRPLSDIRSISDQADNLIEAAKNVLDSLIPFETELHVLNNWILVRIQPYRTTDNFING
VVLTFTDITARIKSATTQEALDLAEGIVNTVREPLIVLDAKMNVISINTAFETSFQVSRE
DAIGRKIYQLGNFQWDIPALRKLLEELLITSDSIDDYVVHHDFPGIGHKTIRIKARRLVT
KMIETQLILLSFEIN
Download sequence
Identical sequences D7DPJ7
WP_013147557.1.57165 gi|297538049|ref|YP_003673818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]