SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297538091|ref|YP_003673860.1| from Methylotenera versatilis 301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297538091|ref|YP_003673860.1|
Domain Number 1 Region: 161-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.16e-71
Family Methylesterase CheB, C-terminal domain 0.000000322
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 6.12e-28
Family CheY-related 0.00000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297538091|ref|YP_003673860.1|
Sequence length 356
Comment response regulator receiver modulated CheB methylesterase [Methylotenera versatilis 301]
Sequence
MKIRVLVIDDSALIRSLLTEIINSQRDMEVVGAAPDPIIAREMIKQLNPDVLTLDVEMPK
MDGLDFLEKLMRLRPMPVVMVSTLTERGSEITMRALELGAIDFVTKPKMSITEGMREYTD
IIADKIRAASQARISTLQRHAMTQSSGAAPAPLRNPLISSEKLLIIGASTGGTEAIKSFL
LQMPSDCPGILITQHMPAGFTKSFANRLDSLCQISVKEAAGGERILPGHAYIAPGDKHLL
LARSGANYVTQLSDEAPVNRHKPSVDVLFASAAEYAGKNVIGVILTGMGKDGAVGMAKMR
DAGAYNFAQNEESCVVYGMPKEAVAHGGVDEVAHLNDLPKLVLNYLMANSSRALRV
Download sequence
Identical sequences D7DPR2
gi|297538091|ref|YP_003673860.1| WP_013147599.1.57165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]