SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125135|ref|YP_003632387.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125135|ref|YP_003632387.1|
Domain Number 1 Region: 3-473
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.61e-143
Family Amylase, catalytic domain 0.000000000398
Further Details:      
 
Domain Number 2 Region: 479-553
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000324
Family alpha-Amylases, C-terminal beta-sheet domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296125135|ref|YP_003632387.1|
Sequence length 556
Comment alpha,alpha-phosphotrehalase [Brachyspira murdochii DSM 12563]
Sequence
MNFKNKVVYQIYPKSFMDSNNDGLGDIRGIISKLDYLSDLGIDIIWTTPFFVSPQKDNGY
DVADYYNVDPSYGTMEDAEELIREAKKRNIDIMFDMVFNHTSTEHEWFKKAINGIEKYKN
YYIFKKGRIINGKKEPPTNWISKFGGSAWQYIEKFDEYYLHLFDVSQADLNWDNEEVRKE
IFDIVNFWISKGVYGFRFDVINLISKPKVFEDDFESDGRRFYTDGINIHKYLKELNKNTF
GKYDNAVTVGEMSSTTIENCIKYSGEKENELSMVFSFHHLKVDYKNKDKWQLMDFDFQEL
KNILFSWQEGMQSNNAWSALFWCNHDQPRIVSRFGDDRKYYKESAKMLASVMHCLRGTPY
IYQGEEIGMTNAYFDNINQYKDVESLNYFNILKNNGVEEKEIYKILQSRSRDNARTPMQW
NDKKNAGFSNADTWIEIIYNYKEINAENNLKDEDSILNYYKKLIRLRKDYKVISEGKTIP
ILKEDKNVLSFIREYNNEKILVINNFYGNECTADLNGINFNIKTSKILISNYNDDLILDN
ILKLKPYESVLLYSKN
Download sequence
Identical sequences D5U4E3
gi|296125135|ref|YP_003632387.1| WP_013112619.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]