SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125159|ref|YP_003632411.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125159|ref|YP_003632411.1|
Domain Number 1 Region: 123-259
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 6.21e-57
Family Dihydrodipicolinate reductase-like 0.00002
Further Details:      
 
Domain Number 2 Region: 2-147
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.61e-36
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00099
Further Details:      
 
Domain Number 3 Region: 289-381
Classification Level Classification E-value
Superfamily 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 7.98e-25
Family 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125159|ref|YP_003632411.1|
Sequence length 384
Comment 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Brachyspira murdochii DSM 12563]
Sequence
MKKRILLLGATGSIGTNTCNVVRNFSSDFEIVGMSANSKIDILRTLCTEFNPKTVNISDK
SAANIFKDYDCAESINIFDGSIADFVKHTDFDILVNALTGYAGFLPTVEAIKKGKTVALA
NKETLVVGGDIINELLKQNNAKLIPIDSEHSAIFQILNHFGKDALSKVIITASGGPFFRT
PKEELKNVTVEMALKHPTWSMGSKITIDSATMMNKGFEVIEAHHLFNLDYDKIETIIHPQ
SLIHSMAEFVDGEIYAQIGKNDMCLPIQHALTYPEIRNTPFEKLKLYEHTELNFYKMDFD
KFVMLKLAYECGKKGGLYPCVLNAANEICVYSFLEKRIGFTDIFDIVSKVCSRKINIPLT
IDNIINMDSEIRKETRWIIDSMTK
Download sequence
Identical sequences D5U4G7
WP_013112643.1.81496 gi|296125159|ref|YP_003632411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]