SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125208|ref|YP_003632460.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125208|ref|YP_003632460.1|
Domain Number 1 Region: 63-248
Classification Level Classification E-value
Superfamily MetI-like 5.76e-32
Family MetI-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125208|ref|YP_003632460.1|
Sequence length 264
Comment nitrate/sulfonate/bicarbonate ABC transporter permease [Brachyspira murdochii DSM 12563]
Sequence
MKDKKRIKLSDFEKPIWAIISIAGFLIVWQLLTTYTPIKITTPKPLEVFKFLLWSINHNI
GQQTILGHVLISIFRVLAGFAIGAVTGIILGISMGVNKYVRAVVRPFFEVFRQIPPIAWI
PMAILWFGIGEVPKIFIIFIGTFVNVTLNAYAGSSQVNPTLIGAAKMLGSNDRDIFLHVI
LPASVPQIFNGMQVGFSVSWMGVLAAEMVSSFAGVGWVIIRGSDTANIPQVLAGMITIGI
VGLLLSSLMRYIEKRLTIWNSTGI
Download sequence
Identical sequences D5U4L6
WP_013112692.1.81496 gi|296125208|ref|YP_003632460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]