SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125512|ref|YP_003632764.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125512|ref|YP_003632764.1|
Domain Number 1 Region: 1-75,166-339
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.97e-89
Family Pyruvate kinase 0.00000348
Further Details:      
 
Domain Number 2 Region: 322-476
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.82e-24
Family Pyruvate kinase, C-terminal domain 0.0048
Further Details:      
 
Domain Number 3 Region: 70-164
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 8.72e-21
Family Pyruvate kinase beta-barrel domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125512|ref|YP_003632764.1|
Sequence length 477
Comment pyruvate kinase [Brachyspira murdochii DSM 12563]
Sequence
MRKTKIIATLGPRWSSEDMIKKIIENGADVCRLNFSFGAYEEHLERINIIRKVSKELRKP
VAILADMQGPKIRIGKLKEPIAVKEGDIVKLSGYKETNDDSIIPTTHSNIAHDVKNGSML
LIADGTIQLIVESSDEASKLVVCKVITGGTILSSKGINLPGAHVTTEVLTEKDINDALFC
AKNGVNYLGMSFVRRAEDVIRLRKILDDNNFQHVAIVSKIENTESLENLEEIIKHSDGVM
VARGDLGVEIPFGEVPVWQKKILKMANDLGKITIIATQMLESMTKSPVPSRAEASDVANA
VLDGTDVVMMSAETASGDYPIESVKAMVSIVEAAERSMIKISHDNMNLLDRGLNDALADS
ASYLSYSLNNKVIIALSRSGRTVKNLSKKRPKTPIVFMSADFNLCNSLSICHNVYTILMP
EDLNFSSGISHSGQIDILEDTIVKHNLANHGDTAIVVSGSKWQGRWQENSVRVVIIH
Download sequence
Identical sequences D5U6J9
gi|296125512|ref|YP_003632764.1| WP_013112991.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]