SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125603|ref|YP_003632855.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125603|ref|YP_003632855.1|
Domain Number 1 Region: 193-359
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000000119
Family GlmU C-terminal domain-like 0.038
Further Details:      
 
Weak hits

Sequence:  gi|296125603|ref|YP_003632855.1|
Domain Number - Region: 481-658
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00746
Family DNA repair protein MutS, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125603|ref|YP_003632855.1|
Sequence length 660
Comment hypothetical protein [Brachyspira murdochii DSM 12563]
Sequence
MYIFKKQDNDFRNLTNEEINFLKSQGCSSQSWEKILIKNVDLSRIKDVQFHGRVKINALN
GNVRYHKKLKVPASINRATLIDVFINGNVYINNIGRFIANYKIEKGVIIENAGSIYMEGK
SSFGNGVETSPIMEGDGRSVKIFNRLNSHIAYLVAIHRHKKLMREKINTIIDEYANQKTR
KFGKIKKYAKIINARLIKNSLIDPYTTIENTDEINNTTVISTKECPSYIGTSVILKDSIV
LKGADITDSTVIKKAFIGEGVRLARQFSCEDSLLFANCEGEHGEMFSIFAGPYTVTHHKA
TLLIASHFSFFNAGSGTNQSNHMYKLGPYHHGFMERGCKTGSNSYILWPSYIGAFSTVIG
AHYDNVDTSDFPFSYITEHGYHQTRLIPALNLFGVGLSRDENKWKDRDRRKGDKKDLIIF
DVFSPYTVSRMIKSEEILKNIKKENNHDDKNFLTYKNMIIKKSSLDKYSKRYSIAIDLYL
HNKILSYIKSSKNIDEIISNLEYDKNNVFDNWSDIGGLICAKDRVDNIIKDLENDKINDI
KTLTEAFEKLYNIYSEDEKSWVMNCIKSRYNIESINKDNIKKLLDEHKILLEKAYDIFYK
DVEKEYDIAKMVSAGIDDKTMMEKDFEAVRGTVNENTFVVKYKKDMENKINDINNLINIL
Download sequence
Identical sequences D5U6U0
WP_013113082.1.81496 gi|296125603|ref|YP_003632855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]