SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125753|ref|YP_003633005.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125753|ref|YP_003633005.1|
Domain Number 1 Region: 245-342
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.09e-16
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 90-174
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000000000248
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0027
Further Details:      
 
Domain Number 3 Region: 176-240
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000425
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296125753|ref|YP_003633005.1|
Sequence length 344
Comment mechanosensitive ion channel MscS [Brachyspira murdochii DSM 12563]
Sequence
MEYLKETIIWNNSLLKYLISVIVFAVSLIAMNIILILFLKVLLKLNTKLQNEFIVNLAKS
IKKRLRPLIFIIALSFARVGLVLPKEVSGYWTKIVVVFFIIFVVMFICDIISNFSNNYLS
NKKGVVISDGIITILKALIWVIGFLTILSNLGVNVNTFIAGLGIGGVAVAFAAQSIIADL
FNYFVIVFDKPFLKGDYIQIDADKGVVEYIGIKSTRIRRNSGEQLLISNTNLLASRIQNY
RILEKRRQYMMLGVEYSTPLEKLKVIPDILKTVIETNNTEFVSARFIEFADSSLNFEVIY
YVNTADYNEFVRVVEDINYKIIDEFNKLGVGFAFPSRTLYISKE
Download sequence
Identical sequences D5U7Y3
WP_013113232.1.81496 gi|296125753|ref|YP_003633005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]