SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125812|ref|YP_003633064.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125812|ref|YP_003633064.1|
Domain Number 1 Region: 443-625
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-37
Family Histidine kinase 0.00000431
Further Details:      
 
Domain Number 2 Region: 626-757
Classification Level Classification E-value
Superfamily CheW-like 2.22e-28
Family CheW-like 0.0002
Further Details:      
 
Domain Number 3 Region: 6-118
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.93e-28
Family Chemotaxis protein CheA P1 domain 0.002
Further Details:      
 
Domain Number 4 Region: 182-253
Classification Level Classification E-value
Superfamily CheY-binding domain of CheA 0.0000000000915
Family CheY-binding domain of CheA 0.0064
Further Details:      
 
Domain Number 5 Region: 318-351
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000153
Family Homodimeric domain of signal transducing histidine kinase 0.0075
Further Details:      
 
Weak hits

Sequence:  gi|296125812|ref|YP_003633064.1|
Domain Number - Region: 395-442
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00628
Family Homodimeric domain of signal transducing histidine kinase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296125812|ref|YP_003633064.1|
Sequence length 802
Comment CheA signal transduction histidine kinase [Brachyspira murdochii DSM 12563]
Sequence
MDDYIKSLLKDFFEEAFEMLDRLEQNILILDNERHNVDAIQEIFRAVHTLKGSAGAVELV
ETQKYAHRFEDLLDLIRNNKIEVDDATIDVLLKGIDILKDLINTASEEGEYSGDIEAEIK
KLEDFKNAKLGGQSSAPETPSSNTSESKEAAAPESEKKVNKYELLPNDSDLLGIIRDNVE
EGVKTKLVHVSFDPESPMRTVGGVQVFVALKDLGEIMGSIPPLESLEGDEFYEHVTYILA
TINEDKTIIDAITLPDVTKEISIEDIILEEYEKFLQEKNQKEAAQKAKEAAAPSANTAKK
PDAAKGGKDHKVDRQSSFLRVESDRIDAMMNQVGELVTNKSSYVQYDDDLTSYQKIIGNG
INEVKRYYRDSIVQVLRKFEEHMQKKEAKEIRNTYIDGFNNKLSELVKMEEEFKNTLDRF
RNSYQLLTRVTNELQETVMKIRMLPIAQTFNRFPRLIRDLSRDLGKEVKLEMYGEETELD
KSVIEVLVDPLVHLVRNAMDHGIESPEDREKAGKPRTGTVVLGASHEGNLIIIKISDDGK
GMIPQKIFESAVKKGLVSADAKLSERQMLEYIFAPGFSTAAKITNVSGRGVGMDVVKKSL
EKINGTIGIETEWGKGSTFFLRIPLTVAIIQALIVDAEKEYYAVPINSILETIKIDVQDI
QELEGIEVIKVRDDVINVLSVKELFRLPSRYNNIKSYYAVILSSEGKKVALLVNNLIGEQ
DIVIKTLKDNITKSEGLAGATVLGDGTVSFILDIQTMVSLGTKRIIERGKVNNSSKTNKN
DLRSFIEKLKNNEIPEVNTNKK
Download sequence
Identical sequences D5U842
gi|296125812|ref|YP_003633064.1| WP_013113291.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]