SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296125994|ref|YP_003633246.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125994|ref|YP_003633246.1|
Domain Number 1 Region: 261-536
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.69e-56
Family beta-glycanases 0.00051
Further Details:      
 
Domain Number 2 Region: 1-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-32
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0084
Further Details:      
 
Domain Number 3 Region: 188-259
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000547
Family beta-Galactosidase/glucuronidase domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125994|ref|YP_003633246.1|
Sequence length 741
Comment glycoside hydrolase 2 [Brachyspira murdochii DSM 12563]
Sequence
MREIINFNTNWQFFKEWNDAIKTEKLNAESVTLPHTVSEIPLHYFDESDTWLITGYQNIF
NYDKAKFQNKRILINFEGAMAAAEVFVNNKSFSEHKGGYLPFVHDITDALKEGENIIAVK
LDSLERDDIPPFGNEIDYLCYGGIYREVQIIIVDDISIENIMITGLGNQNITGKIRIRNS
KKTNSKETVSINLYNREYHICEIKKDIQLQNNELFTDIEIDEHIDSDRIELWTINNPRLY
KLEVSLSNEDSTSVRIGFRDVKFTEDGFYLNGEKIKLRGLNRHQSFPYVGYAMPERIQKK
DADILKFDMGLNIVRSSHYPASRHFLDRCDEIGLMVFEEIPGWQHIGDKEWQKVSIENVK
DMIERDFHHASIIIWGVRINESQDNHNFYKETNEMAHKLDKTRQTGGVRYIVGSELLEDV
YTVNDFNYDGKADPIRAQKCITKLDKNVPYMITEYNGHMFPTKMQDCEERTIEHTKRHYE
IINAVAIDKYLAGSTGWCAFDYHTHYNFGSGDRICYHGVYDMFRNPKLAASAYSSQMCKD
YKIVLEPITIYARGERAIGGVSPLMISTNCDYIEIYHENDLIVKEYPAAGKYQGLKHAPV
IVNMAVNIPGVSDMDWADIKIVGYIDSKPVIEKSYLKNPTFKELEVKADDYEINSISEGS
SWDSTRITVKAVDALGNRLPYINEAVKIKVEGEGELIGNDNPVLEGGYYSFWVKSNSKKG
EIKINVSNKRVETKTISIKVN
Download sequence
Identical sequences D5U8M4
WP_013113473.1.81496 gi|296125994|ref|YP_003633246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]