SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296126131|ref|YP_003633383.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126131|ref|YP_003633383.1|
Domain Number 1 Region: 3-286
Classification Level Classification E-value
Superfamily MetI-like 7.19e-52
Family MetI-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296126131|ref|YP_003633383.1|
Sequence length 290
Comment binding-protein-dependent transport system inner membrane protein [Brachyspira murdochii DSM 12563]
Sequence
MKKNKVLPYILILPAVVIMAVFVLYPIIVTFFYSLRKMKLTAPKDTAFIGFDNYIYTLKS
FDFWYSLQNSIIIMIIVVIICVLLGLLFASILNFESRLKNILMAIAVIPWALPPVVNGIL
WKWIFYPGYGFLNKILYNLNIIDEPIQYLSNRYSLMLIIAIVVAWRNIPFCSIVLLSSMR
AIPDVLYDAASIDGANKFQMFTRVTLPLLVPALGIIITFTSISAINVFDEVITISGYSNL
GKTILLEDYMTTFSFLDFGRGSALTYLVMIVSGTLGILYIKSMSKKIDYL
Download sequence
Identical sequences D5U911
WP_013113609.1.81496 gi|296126131|ref|YP_003633383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]