SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296126133|ref|YP_003633385.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126133|ref|YP_003633385.1|
Domain Number 1 Region: 98-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-45
Family Nitrogenase iron protein-like 0.000014
Further Details:      
 
Domain Number 2 Region: 297-425
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 2.09e-38
Family Signal peptide-binding domain 0.00024
Further Details:      
 
Domain Number 3 Region: 1-93
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 8.9e-19
Family Domain of the SRP/SRP receptor G-proteins 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296126133|ref|YP_003633385.1|
Sequence length 451
Comment GTP-binding signal recognition particle SRP54 G- domain-containing protein [Brachyspira murdochii DSM 12563]
Sequence
MFDNLTKSISNVFSKIHGKKVLTDKDITDSLLTIKEALLSADVSLEAANKFLEEATNRAI
GKEKIEGVEPANQFIADVHDTLVNMIGEGESGLKLEPVEKTTITLLFGLQGSGKTTTTAK
LAKYYKDKRRVMMVGLDVHRPAAMEQLAVLAREVGVPYHIDTKEKKAYKILKKALAIAKK
EQYNMILVDTAGRLEIDENMMMELRRVVNSADVTEKLLVVDSTAGQSVYDVAKSFQSNIG
INGVILTKFDSGVRGGAALSLKYATGSPVKFVGVGEHIDDIDVFDAKRVAGQILGMGDIV
KLVEKARAAISEKEAKEMLQKVIENNFDYNDFLKQIEATTKMGGITKMTSMIPGMANIDT
ELLSREEEKFKKYKAIIQSMTKKERLALFPLNNSRKMRISKGSGQSVYDVNQLIKQFTMM
KNMMGSTKKMDKLAKSLEGMGMSIDDLNKLM
Download sequence
Identical sequences D5U913
gi|296126133|ref|YP_003633385.1| WP_013113611.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]