SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296126249|ref|YP_003633501.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126249|ref|YP_003633501.1|
Domain Number 1 Region: 116-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.76e-46
Family ATP-binding domain of peptide synthetases 0.00041
Further Details:      
 
Domain Number 2 Region: 18-115
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.15e-24
Family D-Alanine ligase N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296126249|ref|YP_003633501.1|
Sequence length 322
Comment D-alanine--D-alanine ligase [Brachyspira murdochii DSM 12563]
Sequence
MMINETLRKDILNRFKNKKIAVLHGGQNEEREVSLRSGKNVYKALTSFEELKDNCILIDV
QDAYDLVKTLKENNIEYCYNILHGTSGEDGTIQGLLESLNIKYTGENILVSAVCMNKVYT
KRIWKSSNVSTSDFVLLKDVKDVNNTSAGGLNFPIIIKPISSGSSVGVSLIKNKEEFDNT
IKKIEDINNYFLEPYIKGKEITVGLVKEEDDIYVFPILGINSKNEIYDYDAKYTPGKTEL
EVPAKISKDIEKKVIETCKRAYTVLGCGGLSRIDAIIANDEVYLMEVNTQSGMTDTSDVP
AMAKNCGIEFADLALYILGLLK
Download sequence
Identical sequences D5U9C9
WP_013113725.1.81496 gi|296126249|ref|YP_003633501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]