SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296126875|ref|YP_003634127.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126875|ref|YP_003634127.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 1.05e-50
Family Ribosomal protein L14 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296126875|ref|YP_003634127.1|
Sequence length 122
Comment 50S ribosomal protein L14 [Brachyspira murdochii DSM 12563]
Sequence
MIQVPSTLNVADNTGVKKLKCIKVLGGSRRRYATLGDVIVCSVTDIIPTCSIEKGKVVKA
VIVRVKKEVRRPDGSYIRFDENAAVIVDDKKEPRGKRIFGPVARELRDRGFMKIVSLAPE
VI
Download sequence
Identical sequences A0A2A4ISH6 D5UB55
WP_013114308.1.14919 WP_013114308.1.81496 gi|296126875|ref|YP_003634127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]