SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296126939|ref|YP_003634191.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126939|ref|YP_003634191.1|
Domain Number 1 Region: 102-312
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.87e-51
Family BC ATP-binding domain-like 0.00000745
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.34e-31
Family BC N-terminal domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 325-415
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.49e-26
Family BC C-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296126939|ref|YP_003634191.1|
Sequence length 417
Comment phosphoribosylamine/glycine ligase [Brachyspira murdochii DSM 12563]
Sequence
MKILVIGSGAREHAICNNLSKNERVSKIYCALGNAGTHREKKCKNVNISTIDEILNFAKN
ENIDLTIVGSEEMLVYGIADKFEENGLKIFGPNKHAAILEGSKAYSKNFMKKYGVKTAEY
ETFTDYNKASEYLNKCSYPIVIKASGLALGKGVLICQDKKEAQNALEDIMIKKIFKEAGD
EIVIEEFLEGYEASILSVTDSNVIIPFISAKDHKKIGDNDTGNNTGGMGVIAPNPYYTKE
AEELFIKDILEPTLKGIKAEKMSFAGIIFFGIMITKKGVYLLEYNVRMGDPETQAVLQLL
DTDYLSIIESAMKKDISSLNIKWKNKHACCVVMASGGYPASYNKGYKIEGIENIKGKCFI
AGAKIDENNNIVTDGGRVLNVVNIADTLEEARKLTYEDIEKIDFKDKYYRKDIGLIK
Download sequence
Identical sequences D5UBB9
gi|296126939|ref|YP_003634191.1| WP_013114367.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]