SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296126997|ref|YP_003634249.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126997|ref|YP_003634249.1|
Domain Number 1 Region: 7-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.49e-25
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296126997|ref|YP_003634249.1|
Sequence length 111
Comment anti-sigma-factor antagonist [Brachyspira murdochii DSM 12563]
Sequence
MEVSVKELENNTAVLKLDGDIDVYTSSDLKDVIFSQIELGAKKIIIDMEDVYYIDSSGIG
VFISALGAFKKVNGKICFVKVTEPVKKVFELTKITSFFPIFTSETEAMDKF
Download sequence
Identical sequences D5UBH7
gi|296126997|ref|YP_003634249.1| WP_013114423.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]