SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127065|ref|YP_003634317.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127065|ref|YP_003634317.1|
Domain Number 1 Region: 278-596
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.36e-79
Family beta-glycanases 0.000000472
Further Details:      
 
Domain Number 2 Region: 3-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-44
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000983
Further Details:      
 
Domain Number 3 Region: 186-277
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.93e-18
Family beta-Galactosidase/glucuronidase domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127065|ref|YP_003634317.1|
Sequence length 601
Comment beta-glucuronidase [Brachyspira murdochii DSM 12563]
Sequence
MVNSMLYPRESRTRRVVDISGMWEFKIDSNNEGRKNGYANGLKDTTFIPVPSSFNDLFTD
KNIREHAGDIWYETSFYLPLEWKDKNVNIRFGCATHEAAVYINGKEVCTHVGGFMPFNAP
VNEAGIFGEKNKLVVVVNNELSNTTLPCGHTETKPSGKKYIKPSFDFFNYAGLNRPVKIT
VTNKEYIYDIDILSDINGSDGIVNYEVHTTGENKVFVKIYDEEGKEAASAEGKNGKIVIK
NAKLWNPKAAYLYKFEACIKNGEELIDEYYLDFGIRTIKVEGTKFLINGKPFYFTGFGKH
EDSETAGRGYNPPVIKRDFELIKWIGANSFRTSHYPYSEEIMQAADREGIVIIDEIAAVG
MFDVGSVLNPGASKADYFSLEEVHTKTKEIHKKAVEELITRDKNHPSVVMWSLFNEPDTS
KDEALPYFEDIFNFAKSIDKQNLPKTFAAIQASAPGKCKCMHLCDVITLNRYYGWYFLGG
YEIDMSEEKFREEMNLYKDMNKPVMFTEYGADTYAGVHKLPSVMWSEEYQCEYYEMNFKV
FDSYDFIIGEQLWNFADFQTTEGIFRVDGNKKGIFTRTRQPKAVAHYIRSRWTKLPLDYK
K
Download sequence
Identical sequences D5U3N6
WP_013114490.1.81496 gi|296127065|ref|YP_003634317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]