SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127204|ref|YP_003634456.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127204|ref|YP_003634456.1|
Domain Number 1 Region: 987-1251
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.25e-67
Family Class I glutamine amidotransferases (GAT) 0.00072
Further Details:      
 
Domain Number 2 Region: 642-824
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 7.33e-36
Family PurM N-terminal domain-like 0.0093
Further Details:      
 
Domain Number 3 Region: 448-614
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 1.64e-33
Family PurM C-terminal domain-like 0.00029
Further Details:      
 
Domain Number 4 Region: 198-225,304-439
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.01e-28
Family PurM N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 5 Region: 825-972
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 0.000000017
Family PurM C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127204|ref|YP_003634456.1|
Sequence length 1252
Comment phosphoribosylformylglycinamidine synthase [Brachyspira murdochii DSM 12563]
Sequence
MNYRIFIEKKDGFNLEAKRLENQLKENFKIKSSVRLLNVYDIFNIEESQLQNSIKVIFSE
PPTDKIVEKKDFEHLKHFAVEYLPGQFDQRADSAVQCLKLIYNNIENVSIVSGKVIVFEG
DIDESTIEKIKKFYINPVESREKDLSKLEIEESQKADDIKDVENFINFNSEELAEYRNNL
DLAMTYKDIEFVQNYFKNEEKRNPTETEIKVLDTYWSDHCRHTTFMTKINDVQLEDTLKE
NKNNFAEVVLNAINRYYDMRKELYGEDVDSKRDINLMDMATVSAKYIKKKGKLEDLEISD
EINACSIYIDADAVDENGNNKKEKYLLMFKNETHNHPTEIEPFGGASTCLGGAIRDPLSG
RSYVYQAIRVTGSANPLEKLEDTLAGKLPQKKITTTAAAGYSSYGNQIGLTTCLVNEIYD
EGYKAKRLEVGAVVGAVPVSYVRREKPKAGDIVIVLGGRTGRDGCGGATGSSKSHTDTSL
RLCGAEVQKGNAPEERKIQRLFRNKEVTKLIKKCNDFGAGGVSVAIGELSDGIDINLDVL
PVKYLGLNGTELAISESQERMAVVVESKDADEFIKLANDENIEATKVAVITDTNRLVMYL
KGKKIVDISRKFLDTNGAKQETNAVLKDIDFENNPFSTKNACSLKSHWFNMAEDLNVASQ
KGLVEMFDSSIGASTVLMPFGGKYQMTPSDVSIQKIPIFDNNAKEINTASAITWGYNPSI
MKWSEFHGGIYSVIESMSKLVSVGADYKNIRLSFQEYFEKLGNDAKKWGKVYSALLGTIY
AQTEFDIPAIGGKDSMSGTFNNISVPSTLISFAVAAINSNDVISPEFKSSNNYVYLIKHN
MKENYMPNIKEIKENFDFLHQNIKDKKILSAYTIKFGGIAEALTKMSFGNRIGIDIKDEL
YFFNLMPASFIAETKEEINYKNAILIGKTINEYKIKVCGEIIDLEEIEKSWLDKLSSVFP
YKTNEEIETYPLAIYERKTPFICKNKKAKPNVLIASFLGTNCEYDTQKAFSDAGASTDIF
VFRNIKPEYIKESIEDMSKKIDNSQIFMIPGGFSAADEPDGSGKFISAILTNEKIKTSIH
KLLERDGLVLGICNGFQALIKSGLLPYGKIGNITENSPTLTFNKIGRHISQMVTTKVVSN
NSPWLYNIPVGSELVVPVSHGEGRFFADENIIKELIKKGQVATQYVNFKSEPTNEFRFNP
NGSAYAIEGIISEDGKVLGKMGHSERYANNLYKNIITKDIYNIFENGVNYFK
Download sequence
Identical sequences D5U476
gi|296127204|ref|YP_003634456.1| WP_013114628.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]