SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127255|ref|YP_003634507.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127255|ref|YP_003634507.1|
Domain Number 1 Region: 292-588
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.62e-76
Family DNA repair protein MutS, domain III 0.00000698
Further Details:      
 
Domain Number 2 Region: 591-825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.38e-59
Family ABC transporter ATPase domain-like 0.000000622
Further Details:      
 
Domain Number 3 Region: 14-120
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 6.67e-43
Family DNA repair protein MutS, domain I 0.0000259
Further Details:      
 
Domain Number 4 Region: 119-291
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.83e-29
Family DNA repair protein MutS, domain II 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127255|ref|YP_003634507.1|
Sequence length 894
Comment DNA mismatch repair protein MutS [Brachyspira murdochii DSM 12563]
Sequence
MQETFFGSDNKEETQKLTPMMRQYKEIKDKYNDSILLFRMGDFYEVFFDDAKVVSDILGL
TLTKRANVPMAGVPYHAIDNYLSKLVKSGMKIAICDQMEDPKTAKGIVKREVTQVITPGT
ISENKYLESKSNNYLASIIVSKSEKNAALSICDISTGELYASEINSNLENQNEAVKEIIN
ELIEEIIRFSPKEIMTIESVSESIIIKEIKNKFSNIFYSTTANYTAEYSYAYKTLTNHFK
TVSLKSFGIEEKPLLISLLGSTIFYIQELSKTSLEHISNIKLYNRKDSMTLDYATIASLE
ILETIRNDNNKMTLFDTIDRTKTSMGARYLKRIIVEPLLNINDINKRLDNVEFFYKNQKF
MYKIRDLLQDIGDIERLASKLALSRINPKELVSLKRFLVTSLEVITELAMNNFEDVNFEE
VNDIKIITDLIERAILEEPKIVINEGDIIKDDYDETLKKYNEARREGRSWIAELEHNYKL
DTGINNLKIRYNNVIGYYIEVTKANASSVPSDFIKRQTLIGSERYTTSKLMEYENIINEA
NEKSYALEYDIFINVRNKTNEYLNSILKMARVISIIDVYSSLACLAKEDNYVKPIITDDG
IIDIKEGRHPVVEVNLKTESFIPNDTYLDSKNEHMLIITGPNMSGKSTYLRQTALIVLLA
QIGSFVPAASAKISIVDRIFTRVGASDNIARGESTFLVEMNETAYILNHCTNKSLVIMDE
IGRGTSTYDGLSIAWAIVEYLVHEENKKAKTLFATHYHELTMLEDLEGVKNYKVLVEEYK
DEIIFMKKVTEGAAQSSYGIYAAKIAGAPNKVIRRASEILKKLETEAGIQVENIELNTQK
SKDILPFYDNTNNDYIIEEKTKESEIEKEIKELNINNITPIDAINLINKWKNMI
Download sequence
Identical sequences D5U4Q4
WP_013114677.1.81496 gi|296127255|ref|YP_003634507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]