SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127501|ref|YP_003634753.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127501|ref|YP_003634753.1|
Domain Number 1 Region: 128-399
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.5e-108
Family BC ATP-binding domain-like 0.000000146
Further Details:      
 
Domain Number 2 Region: 666-930
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.84e-93
Family BC ATP-binding domain-like 0.00000285
Further Details:      
 
Domain Number 3 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.75e-48
Family BC N-terminal domain-like 0.00000618
Further Details:      
 
Domain Number 4 Region: 550-668
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.73e-47
Family BC N-terminal domain-like 0.000009
Further Details:      
 
Domain Number 5 Region: 395-547
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.09e-46
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.000058
Further Details:      
 
Domain Number 6 Region: 932-1056
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.49e-30
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296127501|ref|YP_003634753.1|
Sequence length 1063
Comment carbamoyl-phosphate synthase large subunit [Brachyspira murdochii DSM 12563]
Sequence
MPKRNDIKKILVIGSGPIVIGQAAEFDYAGTQACQSLKEEGYEVILINSNPATIMTDSAV
ADKVYIEPINLNFAKRIIYKERPDAILGSLGGQTGLNLVVELAESGILDEYNVEILGTDL
NAINCAEDRELFKKLMNDINEPVPDSVIVHSVEEAVAFANKIGYHLVVRPAYTLGGTGGG
FARNEKELIEICESGLKISPVHECLVEKSIAGYKEIEYEVMRDNNDNAIVVCNMENVDPV
GIHTGDSIVVAPCQTLSDRENQMLRNASLKIIRALKICGGCNVQLALDPKSFNYYIIEVN
PRVSRSSALASKATGYPIAKISAKIAVGMTLDEILNPITKKSYACFEPSIDYIVTKFPRL
PFDKFPNADRQLGTQMKATGEVMSIGRNFEESFLKAVRSLEIKCDHIMHNDVSNYTTKKL
WERIELRDDLRIFIIAELLRRGEDINDIIYITHIDRFFLEKIKNIIILEEKLENNKMNID
VLRECKERGFSDSYISKVWGIEEIDLYKLRHENNIVPVYKMVDTCAGEFESETPYFYSTY
EKENESVKSGKESIIVLGSGPIRIGQGVEFDYSTVHCVMTIREAGYEAIVINNNPETVST
DFSISDKLYFEPLTIEDVMHIVELEKPRGVIVQFGGQTAINLAEKLVMHGVNILGTSLEN
INKAEDRHEFEEMLKALDIPQPKGKTAFTIDEAVIIAKDIGYPVLVRPSYVLGGRAMEIV
DNDVSLKIYMDTAVKEISNKAPILIDKYVIGKEIEIDAIADSEHNVFIAGIMEHIERAGI
HSGDSISVYPAQTISKKVKDTIIDYTKRIGEGFNFIGLYNIQFIVDKNDNVYVLEVNPRS
SRTVPFLSKITNVQMANAATMCILGKSLKEQGYNNIYKEESKNVFVKAPVFSFAKLRRVD
TILGPEMKSTGEALGFDVNFEKALYKALIASGVKIPLQGNVLLTISDNHKDEVLDLAKRF
SNIGYGIYATKGTANFLRREGLYVKEVSKIDEEGFENIVDTIRLGRVDYVINTIETNSQT
HSDSLELRRASAENNISCITSLDTAYALLRVIESMNFSIMPIA
Download sequence
Identical sequences D5U655
WP_013114892.1.81496 gi|296127501|ref|YP_003634753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]