SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127664|ref|YP_003634916.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127664|ref|YP_003634916.1|
Domain Number 1 Region: 118-710
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 9.03e-158
Family Molybdenum cofactor-binding domain 0.000000882
Further Details:      
 
Domain Number 2 Region: 9-127
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 5.89e-27
Family CO dehydrogenase molybdoprotein N-domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296127664|ref|YP_003634916.1|
Sequence length 711
Comment aldehyde oxidase [Brachyspira murdochii DSM 12563]
Sequence
METFIKELRNSVPRVDALDKITGKTKYLNDIDFGKDILHAKIVYSTKARAKILKINIPEL
PDGYFTVDYRDVPGKNMTAMVVSDWPPFAEDTVRYIGETILLVVGPDKNIVYDIAEKIVI
EYEDLEASLTIDDSKKLLGGAIVGDDNIFVSFKAGYGDVDNAFKKAKTIIEETYYTPYQE
HLYMEVNGAVGIWENGKVLIYSSTQCPYYVRKAAAPVLGVEDDELRIIAPPIGGGFGGKE
HYPDILAAAVAVAAYKVKKTVKLILDRQFDMAYSVKRQPAQITTKAALDENNNIIAIDIV
SDMDAGAYEASSRVIMQRCTYTAANVYNFPNVRVLGRLYATNNVPSCAFRGFGGPQAIFA
IERTMDNIAQKIGVDPIELKRKYFVKKNDPTITGGMFHDNIILPQMLEWALKESDYERKA
KEYKNTMYKGIGISCFLHGCAFTGSGERDIIKAKLKLRKKGNKVIILTSNTEIGQGLHTT
FKKIAAYNLGIPLENIEIAEYDTEIVPNTGPTVASRSVMIVGYLIQEASKKLKQRWNESE
EIEIIEDYKHPTHLIDWDTSALRGDAYPSYGLGINVVEVEIDKVTLEVKIVGVWAVFDCG
YPIDEKIVEGQIKGGVAQALGWGALEKIVNKNGRFLQVKMSDYMIPTSLDLPEIKTCIMC
EPYEYGPLGAKGVGEITFDGAASAYASAMENALNYHFTSIPILPENIAEVL
Download sequence
Identical sequences D5U6Z3
WP_013115053.1.81496 gi|296127664|ref|YP_003634916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]