SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127672|ref|YP_003634924.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127672|ref|YP_003634924.1|
Domain Number 1 Region: 293-849
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 2.62e-148
Family Molybdenum cofactor-binding domain 0.00000417
Further Details:      
 
Domain Number 2 Region: 163-310
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 9.03e-38
Family CO dehydrogenase molybdoprotein N-domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 73-160
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.19e-24
Family CO dehydrogenase ISP C-domain like 0.00035
Further Details:      
 
Domain Number 4 Region: 7-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.67e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127672|ref|YP_003634924.1|
Sequence length 856
Comment selenium-dependent molybdenum hydroxylase 1 [Brachyspira murdochii DSM 12563]
Sequence
MGESVNIIINGKEMSFDSDRKLMDVLRNDCKCKSVKDGCSEGACGTCTVLIDGKPTKACI
QTIGRLQGKSVQTIEGFTQREKDVYSHAFAVAGAVQCGFCIPGMVICAKGLIDKNNNPTR
LEIVAAIKNNICRCTGYKKIIDAVELAAKMIRENIDVKDYKGKVKLGDRNIARIDAKEKA
LGTGEYCDDVEIEGMLYGVAVRTKYPRAKILKIDTSEAKALKGVVDVITAKDLPGAKKIG
HIFHDWDVLIGEGETTRFIADGLALIVAEDENTAKKARDLVKVEYEELPLVRNPEEAMKA
DAPLVHEERESNLLTHERLVKGNADEVIAKSKYKVTRHYELPWTEHAFMEAEVAVAMPFN
DGVFIYSSDQSVYDTKREVSMALGIEPDKVVVENKYVGGGFGGKEDMSVQHYAAIMAYRT
KRPVKFKLTRQESINWHPKRHPMSIDMTTACDENGILTAMKATLITDAGAYASLSGPVLQ
RACTHAAGPYNYQVIDIDGKSFYTNNPPTGPFRGFGVPQSCFATEMNINLLAEMCGLDPW
EIRYRNAIRPGQVLPNYQIADEATGLVETLEAVKDIYYNNKNVGIACALKNSGVGVGLPD
TGRVRLVVEDEKVHVYSAASCIGQGIATVLYQIAGETLDLDDDKIIVHQPNTATSPDSGT
TSGSRQTLITGEACKRACEDLKKELDKGKTLKDLEGKEFYGEWLTITDKMGVDKPHPISH
VAYSYATQVCILNDDGTIQKIVAAHDIGKAINPIALEGQIEGGVVMSLGYALTEKFPLEN
CVPKVKFGTLGLFRADKTPDVESIIIEKPGVPYGYGATGIGEISSIPTAPAVALAYYKFN
GEFQTELPLKNTPYSK
Download sequence
Identical sequences D5U701
gi|296127672|ref|YP_003634924.1| WP_013115061.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]