SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127751|ref|YP_003635003.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127751|ref|YP_003635003.1|
Domain Number 1 Region: 107-310
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.27e-38
Family BC ATP-binding domain-like 0.057
Further Details:      
 
Domain Number 2 Region: 436-713
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0000000000000256
Family FMN-linked oxidoreductases 0.0026
Further Details:      
 
Domain Number 3 Region: 4-63
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.000000719
Family BC N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296127751|ref|YP_003635003.1|
Sequence length 723
Comment ATPase [Brachyspira murdochii DSM 12563]
Sequence
MKGKRIIIIGAGLLQVPAIQIAQEMGLYTIVFDYNKDAHGMKIADYPMVVSTRDVDGSVR
AARDLSQKMEINGVITVGTDASTTVAAVANALGLPGNRFEDAYAASNKIRMRERFKKNNV
PQPNFFPVWNYDEAIDAYRHLNTPVVVKPADNMGARGVMKVSNENDILAAFNRAKSASPS
GEVIIEEFMDGPELSIDMLIYNDEIYVTGVADRIIEFPPFFIETGHIMPSALEKEKLDDA
VNVMKAGIKALNLKIGAAKGDIKVTKNGAMVGEIAARLSGGFMSAYTYPLSTGVNLIKNA
IEIALGNPPSDLKPKWNKVSIERAFLPGTGIIESIEGVENAKKVEGIKEVFIKTKAGDIL
VTPTNNLEKAGNIIAVGNTRDEAIAIANKAMNCVHFKLTDEKSITAEEINRIAHEKLASK
QSANYLFKGDTDEKTGLSHYSFNPSIIHEEKQVNLETNIFNMHLSQPIILDTIYNLPEVI
DGIMDIREYYEIVLDAASNCEVLAILNDFNNEELFELSIRTIKGSKRGIIMIDGNNPHEV
ILQRLRAAEKNGACAVGIDLSYCYNITSHNKIYVKSEKELSKIIKEIDIPIIIKGISNEN
DIHNVNSSHANSIYFSNNNKYALKGMEKVADTINRAACNLHNNHKMQLTLLAESPRYGAD
TFKYFMLGANAVCITEESFIAAISKGKKGLEYALYSNKLELEKIMKIFGQTALKYNNAIW
RKN
Download sequence
Identical sequences D5U780
gi|296127751|ref|YP_003635003.1| WP_013115140.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]