SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127840|ref|YP_003635092.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127840|ref|YP_003635092.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.44e-43
Family Ribosomal protein L20 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127840|ref|YP_003635092.1|
Sequence length 117
Comment 50S ribosomal protein L20 [Brachyspira murdochii DSM 12563]
Sequence
MRAVSGVVRKKKVKKILKMAKGYYGSHSKQMKQAKEAVIRGLKYAYRDRRQKKRMMRRLW
TLRINAACRPLGISYSKFINGLKKANVIIDRKALSNLAIDDYKAFEAVVEVAKKALA
Download sequence
Identical sequences A0A1E5NNT9 A0A2A4INH9 D5U7U7
gi|296127840|ref|YP_003635092.1| WP_008725909.1.101799 WP_008725909.1.14919 WP_008725909.1.32107 WP_008725909.1.53986 WP_008725909.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]