SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296125136|ref|YP_003632388.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296125136|ref|YP_003632388.1|
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000165
Family Tetracyclin repressor-like, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296125136|ref|YP_003632388.1|
Sequence length 188
Comment TetR family transcriptional regulator [Brachyspira murdochii DSM 12563]
Sequence
MKNDKKDLRIIKTQKLLKESLLELLKSNSLKDISVTEICEHALVNRVTFYDHFNNKEELL
NSIINDIKEDIIKELRKDNSIYDFRKNYRKILEKVINYFDYNRQYFNVSLIDSNNTLLFV
SSLYRIFSEYLDETMKSENAENTKIMSQFFSGALVSVILCWVKDDDNKKIKKEDLLNNIC
ILLEKSFK
Download sequence
Identical sequences D5U4E4
WP_013112620.1.81496 gi|296125136|ref|YP_003632388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]