SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296127550|ref|YP_003634802.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296127550|ref|YP_003634802.1|
Domain Number 1 Region: 520-926
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.67e-144
Family DNA polymerase I 0.00000000691
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily PIN domain-like 4.66e-45
Family 5' to 3' exonuclease catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 339-516
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.02e-40
Family DnaQ-like 3'-5' exonuclease 0.00021
Further Details:      
 
Domain Number 4 Region: 172-287
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 5.23e-34
Family 5' to 3' exonuclease, C-terminal subdomain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296127550|ref|YP_003634802.1|
Sequence length 926
Comment DNA polymerase I [Brachyspira murdochii DSM 12563]
Sequence
MKKTFLIIDAFGILYRYHFIFLKRPLLNSKGQNVSSINGFMRTYFSLINTYPAEYTAIAL
DSSRKTFRNEIYKEYKENRESMPDDLRSQIPILYNLIDALGISRIVLDNYEADDIVGTIA
EKNKKENIKTIIYSPDKDILQLVCDDVRVVASNKDNELMEYDEETVKEKRGVYPNQIIDL
LALMGDASDNIPGVKGVGEKTALKLLEEYKSLDGIYENIDSIKGKVQEKLIESKDMAYMS
YKLATIEKNIKDFNLDYNEIAKNKINIEEVNKILDELELKQIRDKINSYIYGVSSKKEEK
VKILNNTDDSSKSEENKEDKKEESPILSAKDNKASYYLIENETELKNLLNDINSKKLVCV
DFETTGLDVFKDTIIGISFAIRSNEAFYLDVSGRTNIDKDKCIDMVFETLAKEDIKVIGH
NLKYEYKMMRAINKSFGNMYFDTMVAAYLINPTRGRYNMDDLAIAYLSYNTIKYSDITDN
AKKTLLDVPLKDVVEYACEDADITFRFYECFAPLLKTHNLEELFFNIEMPLVSVLADMEF
DGVYISSEKMKALSDEYSSLLEKTKKKIYAEAGEEFNIQSPKQLEYILFDKMGIPPTKKT
KTGFSTDEEVLTELSQKYKIAEYMLTYRKYAKLKNTYLDVFPTLINEKTGRIHASFNQTV
TATGRLSSSEPNLQNIPVRGEEGREIRNTFIAEKGNLLIAADYSQIELRLLAHFSNDPAL
VEAFKNNDDIHRKTAMKIYSVSKEHVTASMRNIAKIINFSIIYGKTAFGLSKELGIKRKE
AEDFIKGYFSTYSRVKPFCEEVVEEVRNKGYVRTMCGRIRDLSKTINSSNAMARNEAERM
ALNTLIQGSAADMIKVAMVAIHKEFKNHFKTAKIVMQVHDELVVEVSEKEADKAMTIMKE
IMEHSVKTNVPITVDIHKGNSWGEVH
Download sequence
Identical sequences D5U6A4
WP_013114940.1.81496 gi|296127550|ref|YP_003634802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]