SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877269|ref|YP_003845833.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877269|ref|YP_003845833.1|
Domain Number 1 Region: 140-419
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.11e-64
Family NOL1/NOP2/sun 0.00000207
Further Details:      
 
Domain Number 2 Region: 2-147
Classification Level Classification E-value
Superfamily NusB-like 2.29e-25
Family RmsB N-terminal domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877269|ref|YP_003845833.1|
Sequence length 421
Comment sun protein [Gallionella capsiferriformans ES-2]
Sequence
MHNIQLAATQIVQQVMEDGRNLNQVLDESLRRKSVWTPAQRAALQDLSYGTLRFYGQLNA
ILELLLHKHMTDHRISYLLLVALYQLQYSRAAQHAVVDHAVRSADILNPKIRGLVNAILR
NFLRNQADLLTQAALKDEGHYSHPQWWIDELRAQYGDAADAILIAGNGHPPMTLRVNAQR
GSTPDYLAQLAAQDIPARLIGAEALQLEKPVSVDKLPGFFDGLVSVQDAGAQYAARLLDA
KAGMRVLDACAAPGGKTAHILERADVELLALDKDAARLSRVKENLQRLTLNAALLTGDAA
SPSDWWDGRLFERILADVPCSATGVVRRHPDIKWLRRKKDLASFAEQQFEILNALWPLLA
PGGLLLYATCSVFKQENQQVVDKFLAQTPAAQQRDTGLPGGMLLPDDEHDGFFYALLQKT
V
Download sequence
Identical sequences D9SHN6
WP_013292012.1.12990 gi|302877269|ref|YP_003845833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]