SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877347|ref|YP_003845911.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877347|ref|YP_003845911.1|
Domain Number 1 Region: 687-937
Classification Level Classification E-value
Superfamily EAL domain-like 5.23e-88
Family EAL domain 0.001
Further Details:      
 
Domain Number 2 Region: 511-673
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.47e-47
Family GGDEF domain 0.00013
Further Details:      
 
Domain Number 3 Region: 393-502
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.44e-26
Family Flavin-binding PAS domain 0.019
Further Details:      
 
Domain Number 4 Region: 270-373
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.52e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 5 Region: 202-248
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000085
Family HAMP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877347|ref|YP_003845911.1|
Sequence length 951
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MNRRLSLLIPLILLIVTLGSSSLIYLQQDRATQAAIQRAAITDVTQQMGGLQNILYNRLT
ADDEAEALLSLSIAATHPSIRTLMLVDERHHVLMANQYRWKGEAASSFSSYDDNEADRVL
NRGVRKLEFDAHEPTLLQGYFPLITEYKQGGLEKTMGVLYVGYDTRHELQKAKQETLMQT
AIFVAISLFASFVIGILLHVLVTRRVNLLSAISKQFAAGNYNARSELKGNDELSELGRSF
DTMALRVTENIALQQRAQDFLSEAQKIGHFGSWELDLHSGRLNWSEEIFRLFEIDPAQFS
PSHEAFLSIIHPEDREAVNQAYTNSLTNKQSYHITHRLIMADGRVKWVEARGSNYFDPEG
RAIRSAGTVQDVTFREEAATQLRIAAVAFDTQEAIMVTDKEANIIKVNHSFELTTGFSEQ
EVLGKNPRLLGSGRHNQDFYKSMWEVLNRVGSWSGELWDRRKNGEIYPKWLTITAVKNRD
EISHYVGVFVDITERKKAEEEIHNLAFFDPLTQLPNRRLLLDRMRLALGLSARSKNFGAL
MFIDLDHFKVLNDTKGHEYGDKMLIEVSHRLTQSLRDTDSVARFGGDEFVVLLESLSVNQ
DIAVAQAGSIAEKMRESLSQTYIIESYAHESTPSIGVVLFNGDAIEIDELLKRADLAMYQ
AKESGRNTVRFFESAMQATLESRTLMERALRQALSNSEFELYYQVQTNQANELLGAEVLL
RWHSQSLGPISPAQFIPLAEQTKLILPIGEWVLENACARLKAWETHPTLSKLRLAVNISP
VQFHQPDFVRQVQAALTDSGVNPRRLELELTENLVLEDVDEAIQKMSALKALGVRFSMDD
FGTGYSSLQYIKRLPIDQLKIDQSFVRDILTDPGDAMMVQTIAGMARNFGYEVIAEGVEE
HAQLLPLIERGCNTFQGYFFSRPVALAEFEHLINHWVAFDSSSPSPSRRQL
Download sequence
Identical sequences D9SI90
WP_013292090.1.12990 gi|302877347|ref|YP_003845911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]