SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877363|ref|YP_003845927.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877363|ref|YP_003845927.1|
Domain Number 1 Region: 127-298
Classification Level Classification E-value
Superfamily GAF domain-like 2.21e-40
Family GAF domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 305-479
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-34
Family Phytochrome-specific domain 0.00042
Further Details:      
 
Domain Number 3 Region: 2-105
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000246
Family BphP N-terminal domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302877363|ref|YP_003845927.1|
Sequence length 481
Comment putative phytochrome sensor protein [Gallionella capsiferriformans ES-2]
Sequence
MAHCEAEPLAYSGAIQPHGGLLCLDVHLSMSHVSEQIEKFVTTPLRAGDTLSDELGAVLF
PVIATLPQVPGSRCELFAVDSIGPLPLDIVVIRSNASIIVELIPHTVRVDAVEFAQQTVR
PPANDGEVQALHEKISARFYELTGFDRVMVYVFRDDGDGDGEVLAETRREAVYGSYLGLR
FPGSDIPAIARALYMKNPWRLIQDCQAEAVSLCSNGSAPPDLTWSDLRSVSPMHLRYLAN
MGVSASLSFPIVAGGVLWGLIACHHARPRNLPLVTLCLAAREASHYSLEISNWQVRLQMR
FNDELTDRLNTIRRALLRHGHALSALTEISSIVMAQFDGCGLAVCQGDVWGVAGEVPALY
ELELLDEWLESQGDELINGCDCIGHAIHALVPVAGVLAFRLMTRRRELLSIFIFRREILH
EVEWGGNPHKPVEYQQGDIMISPRRSFEKWIEKRIGYSRPWQKQDRISAMRLRLLLVNLY
C
Download sequence
Identical sequences D9SIA6
gi|302877363|ref|YP_003845927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]